Anti AVL9 pAb (ATL-HPA050957)
Atlas Antibodies
- SKU:
- ATL-HPA050957-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: AVL9
Alternative Gene Name: KIAA0241
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029787: 94%, ENSRNOG00000013314: 95%
Entrez Gene ID: 23080
Uniprot ID: Q8NBF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE |
Gene Sequence | PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE |
Gene ID - Mouse | ENSMUSG00000029787 |
Gene ID - Rat | ENSRNOG00000013314 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti AVL9 pAb (ATL-HPA050957) | |
Datasheet | Anti AVL9 pAb (ATL-HPA050957) Datasheet (External Link) |
Vendor Page | Anti AVL9 pAb (ATL-HPA050957) at Atlas Antibodies |
Documents & Links for Anti AVL9 pAb (ATL-HPA050957) | |
Datasheet | Anti AVL9 pAb (ATL-HPA050957) Datasheet (External Link) |
Vendor Page | Anti AVL9 pAb (ATL-HPA050957) |