Anti AVL9 pAb (ATL-HPA050957)

Atlas Antibodies

SKU:
ATL-HPA050957-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
  • Immunofluorescent staining of human cell line PC-3 shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: AVL9 homolog (S. cerevisiase)
Gene Name: AVL9
Alternative Gene Name: KIAA0241
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029787: 94%, ENSRNOG00000013314: 95%
Entrez Gene ID: 23080
Uniprot ID: Q8NBF6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE
Gene Sequence PNHPFQGQYSVSDMKLRFSHSVQNSERGKKIGNVMVTTSRNVVQTGKAVGQSVGGAFSSAKTAMSSWLSTFTTSTSQSLTEPPDE
Gene ID - Mouse ENSMUSG00000029787
Gene ID - Rat ENSRNOG00000013314
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti AVL9 pAb (ATL-HPA050957)
Datasheet Anti AVL9 pAb (ATL-HPA050957) Datasheet (External Link)
Vendor Page Anti AVL9 pAb (ATL-HPA050957) at Atlas Antibodies

Documents & Links for Anti AVL9 pAb (ATL-HPA050957)
Datasheet Anti AVL9 pAb (ATL-HPA050957) Datasheet (External Link)
Vendor Page Anti AVL9 pAb (ATL-HPA050957)