Anti ATXN10 pAb (ATL-HPA049531)

Atlas Antibodies

SKU: ATL-HPA049531-25

• 
• 
• 

Protein Description: ataxin 10
Gene Name: ATXN10
Alternative Gene Name: E46L, FLJ37990, SCA10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000016541: 72%, ENSRNOG00000014637: 82%
Entrez Gene ID: 25814
Uniprot ID: Q9UBB4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTF
• Gene Sequence: KHPESEWPFLIITDLFLKSPELVQAMFPKLNNQERVTLLDLMIAKITSDEPLTKDDIPVFLRHAELIASTF
• Gene ID - Mouse: ENSMUSG00000016541
• Gene ID - Rat: ENSRNOG00000014637
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.