Protein Description: alpha thalassemia/mental retardation syndrome X-linked
Gene Name: ATRX
Alternative Gene Name: JMS, MRX52, RAD54, XH2, XNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031229: 51%, ENSRNOG00000056703: 57%
Entrez Gene ID: 546
Uniprot ID: P46100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATRX
Alternative Gene Name: JMS, MRX52, RAD54, XH2, XNP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031229: 51%, ENSRNOG00000056703: 57%
Entrez Gene ID: 546
Uniprot ID: P46100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE |
| Documents & Links for Anti ATRX pAb (ATL-HPA064684) | |
| Datasheet | Anti ATRX pAb (ATL-HPA064684) Datasheet (External Link) |
| Vendor Page | Anti ATRX pAb (ATL-HPA064684) at Atlas |
| Documents & Links for Anti ATRX pAb (ATL-HPA064684) | |
| Datasheet | Anti ATRX pAb (ATL-HPA064684) Datasheet (External Link) |
| Vendor Page | Anti ATRX pAb (ATL-HPA064684) |
| Citations for Anti ATRX pAb (ATL-HPA064684) – 1 Found |
| de Nonneville, Alexandre; Salas, Sébastien; Bertucci, François; Sobinoff, Alexander P; Adélaïde, José; Guille, Arnaud; Finetti, Pascal; Noble, Jane R; Churikov, Dimitri; Chaffanet, Max; Lavit, Elise; Pickett, Hilda A; Bouvier, Corinne; Birnbaum, Daniel; Reddel, Roger R; Géli, Vincent. TOP3A amplification and ATRX inactivation are mutually exclusive events in pediatric osteosarcomas using ALT. Embo Molecular Medicine. 2022;14(10):e15859. PubMed |