Anti ATP8A1 pAb (ATL-HPA052935 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA052935-25

• 
• 
• 

Protein Description: ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
Gene Name: ATP8A1
Alternative Gene Name: ATPIA
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037685: 100%, ENSRNOG00000034200: 100%
Entrez Gene ID: 10396
Uniprot ID: Q9Y2Q0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI
• Gene Sequence: KSQDPGAVVLGKSLTERAQLLKNVFKKNHVNLYRSESLQQNLLHGYAFSQDENGIVSQSEVI
• Gene ID - Mouse: ENSMUSG00000037685
• Gene ID - Rat: ENSRNOG00000034200
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP8A1 pAb (ATL-HPA052935 w/enhanced validation) – 1 Found

Laferrière, Florent; Claverol, Stéphane; Bezard, Erwan; De Giorgi, Francesca; Ichas, François. Similar neuronal imprint and no cross-seeded fibrils in α-synuclein aggregates from MSA and Parkinson's disease. Npj Parkinson's Disease. 2022;8(1):10.