Anti ATP7A pAb (ATL-HPA048107)

Atlas Antibodies

SKU: ATL-HPA048107-25

• 

Protein Description: ATPase, Cu++ transporting, alpha polypeptide
Gene Name: ATP7A
Alternative Gene Name: MNK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033792: 78%, ENSRNOG00000061367: 76%
Entrez Gene ID: 538
Uniprot ID: Q04656
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTI
• Gene Sequence: LKTKGVTDIKIYPQKRTVAVTIIPSIVNANQIKELVPELSLDTGTLEKKSGACEDHSMAQAGEVVLKMKVEGMTCHSCTSTI
• Gene ID - Mouse: ENSMUSG00000033792
• Gene ID - Rat: ENSRNOG00000061367
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATP7A pAb (ATL-HPA048107) – 1 Found

Singh, Varsha; Yang, Jianbo; Yin, Jianyi; Cole, Robert; Tse, Ming; Berman, Diego E; Small, Scott A; Petsko, Gregory; Donowitz, Mark. Cholera toxin inhibits SNX27-retromer-mediated delivery of cargo proteins to the plasma membrane. Journal Of Cell Science. 2018;131(16)