Anti ATP6V1F pAb (ATL-HPA048700)

Atlas Antibodies

SKU: ATL-HPA048700-25

• 

Protein Description: ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F
Gene Name: ATP6V1F
Alternative Gene Name: ATP6S14, VATF, Vma7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047810: 34%, ENSRNOG00000054336: 37%
Entrez Gene ID: 9296
Uniprot ID: Q16864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFL
• Gene Sequence: DTFRSLGSLPGSVVEANPNQRDPPLWDEIDSRQFL
• Gene ID - Mouse: ENSMUSG00000047810
• Gene ID - Rat: ENSRNOG00000054336
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.