Anti ATP6V1E2 pAb (ATL-HPA052784)

Atlas Antibodies

SKU: ATL-HPA052784-100

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 31kDa, V1 subunit E2
Gene Name: ATP6V1E2
Alternative Gene Name: ATP6E1, ATP6EL2, ATP6V1EL2, MGC9341, VMA4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053375: 63%, ENSRNOG00000015566: 66%
Entrez Gene ID: 90423
Uniprot ID: Q96A05
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKV
• Gene Sequence: YMTISQKHVEVQIDKEAYLAVNAAGGVEVYSGNQRIKV
• Gene ID - Mouse: ENSMUSG00000053375
• Gene ID - Rat: ENSRNOG00000015566
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.