Anti ATP6V0D2 pAb (ATL-HPA055327 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055327-100

• 
• 

Protein Description: ATPase, H+ transporting, lysosomal 38kDa, V0 subunit d2
Gene Name: ATP6V0D2
Alternative Gene Name: ATP6D2, FLJ38708, VMA6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028238: 86%, ENSRNOG00000006926: 86%
Entrez Gene ID: 245972
Uniprot ID: Q8N8Y2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
• Gene Sequence: EDRETLYPTFGKLYPEGLRLLAQAEDFDQMKNVADHYGVYKPLFEAVGGSG
• Gene ID - Mouse: ENSMUSG00000028238
• Gene ID - Rat: ENSRNOG00000006926
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.