Anti ATP6AP1L pAb (ATL-HPA053771)

Atlas Antibodies

SKU:
ATL-HPA053771-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATPase, H+ transporting, lysosomal accessory protein 1-like
Gene Name: ATP6AP1L
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078958: 71%, ENSRNOG00000040201: 69%
Entrez Gene ID: 92270
Uniprot ID: Q52LC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPA
Gene Sequence AVFNPTGVYAPSGYSYRCQRVGSLQQDQALLLPSDTDDGSSLWEVTFIDFQIQGFAIKGGRFTKAQDCASSFSPA
Gene ID - Mouse ENSMUSG00000078958
Gene ID - Rat ENSRNOG00000040201
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP6AP1L pAb (ATL-HPA053771)
Datasheet Anti ATP6AP1L pAb (ATL-HPA053771) Datasheet (External Link)
Vendor Page Anti ATP6AP1L pAb (ATL-HPA053771) at Atlas Antibodies

Documents & Links for Anti ATP6AP1L pAb (ATL-HPA053771)
Datasheet Anti ATP6AP1L pAb (ATL-HPA053771) Datasheet (External Link)
Vendor Page Anti ATP6AP1L pAb (ATL-HPA053771)