Anti ATP5G2 pAb (ATL-HPA051469)

Atlas Antibodies

SKU: ATL-HPA051469-25

• 

Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit C2 (subunit 9)
Gene Name: ATP5G2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062683: 57%, ENSRNOG00000015320: 58%
Entrez Gene ID: 517
Uniprot ID: Q06055
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
• Gene Sequence: LCLLCSGSSSPATAPHPLKMFACSKFVSTPSLVKSTSQLLSRPLSAVVLKRPEILTDESLSSLAVSCPLTSLVSSRSFQ
• Gene ID - Mouse: ENSMUSG00000062683
• Gene ID - Rat: ENSRNOG00000015320
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.