Anti ATP5F1 pAb (ATL-HPA046067 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA046067-100

• 
• 

Protein Description: ATP synthase, H+ transporting, mitochondrial Fo complex, subunit B1
Gene Name: ATP5F1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000563: 81%, ENSRNOG00000046299: 79%
Entrez Gene ID: 515
Uniprot ID: P24539
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: QLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKN
• Gene Sequence: QLEEAKQASIQHIQNAIDTEKSQQALVQKRHYLFDVQRNNIAMALEVTYRERLYRVYKEVKN
• Gene ID - Mouse: ENSMUSG00000000563
• Gene ID - Rat: ENSRNOG00000046299
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.