Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA045400-25
  • Immunohistochemistry analysis in human stomach and pancreas tissues using Anti-ATP4B antibody. Corresponding ATP4B RNA-seq data are presented for the same tissues.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ATPase, H+/K+ exchanging, beta polypeptide
Gene Name: ATP4B
Alternative Gene Name: ATP6B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031449: 83%, ENSRNOG00000018543: 80%
Entrez Gene ID: 496
Uniprot ID: P51164
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Gene Sequence TPDYQDQLRSPGVTLRPDVYGEKGLEIVYNVSDNRTWADLTQTLHAFLAGYSPAAQEDSINCTSEQYFFQESFRAPNHTKFSCKFTADML
Gene ID - Mouse ENSMUSG00000031449
Gene ID - Rat ENSRNOG00000018543
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation)
Datasheet Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation)
Datasheet Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ATP4B pAb (ATL-HPA045400 w/enhanced validation)