Anti ATP2C2 pAb (ATL-HPA075812)

Atlas Antibodies

SKU:
ATL-HPA075812-25
  • Immunofluorescent staining of human cell line HaCaT shows localization to plasma membrane & focal adhesion sites.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATPase, Ca++ transporting, type 2C, member 2
Gene Name: ATP2C2
Alternative Gene Name: KIAA0703, SPCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034112: 77%, ENSRNOG00000049334: 77%
Entrez Gene ID: 9914
Uniprot ID: O75185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM
Gene Sequence WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM
Gene ID - Mouse ENSMUSG00000034112
Gene ID - Rat ENSRNOG00000049334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP2C2 pAb (ATL-HPA075812)
Datasheet Anti ATP2C2 pAb (ATL-HPA075812) Datasheet (External Link)
Vendor Page Anti ATP2C2 pAb (ATL-HPA075812) at Atlas Antibodies

Documents & Links for Anti ATP2C2 pAb (ATL-HPA075812)
Datasheet Anti ATP2C2 pAb (ATL-HPA075812) Datasheet (External Link)
Vendor Page Anti ATP2C2 pAb (ATL-HPA075812)