Anti ATP2C2 pAb (ATL-HPA075812)

Atlas Antibodies

SKU: ATL-HPA075812-25

• 

Protein Description: ATPase, Ca++ transporting, type 2C, member 2
Gene Name: ATP2C2
Alternative Gene Name: KIAA0703, SPCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034112: 77%, ENSRNOG00000049334: 77%
Entrez Gene ID: 9914
Uniprot ID: O75185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM
• Gene Sequence: WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM
• Gene ID - Mouse: ENSMUSG00000034112
• Gene ID - Rat: ENSRNOG00000049334
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.