Protein Description: ATPase, Ca++ transporting, type 2C, member 2
Gene Name: ATP2C2
Alternative Gene Name: KIAA0703, SPCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034112: 77%, ENSRNOG00000049334: 77%
Entrez Gene ID: 9914
Uniprot ID: O75185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATP2C2
Alternative Gene Name: KIAA0703, SPCA2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034112: 77%, ENSRNOG00000049334: 77%
Entrez Gene ID: 9914
Uniprot ID: O75185
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | WMAVKCSLKTEDQEDIYFMKGALEEVIRYCTMYNNGGIPLPLTPQQRSFCLQEEKRM |
Documents & Links for Anti ATP2C2 pAb (ATL-HPA075812) | |
Datasheet | Anti ATP2C2 pAb (ATL-HPA075812) Datasheet (External Link) |
Vendor Page | Anti ATP2C2 pAb (ATL-HPA075812) at Atlas |
Documents & Links for Anti ATP2C2 pAb (ATL-HPA075812) | |
Datasheet | Anti ATP2C2 pAb (ATL-HPA075812) Datasheet (External Link) |
Vendor Page | Anti ATP2C2 pAb (ATL-HPA075812) |