Anti ATP1B3 pAb (ATL-HPA048963)

Atlas Antibodies

SKU: ATL-HPA048963-25

• 
• 

Protein Description: ATPase, Na+/K+ transporting, beta 3 polypeptide
Gene Name: ATP1B3
Alternative Gene Name: CD298, FLJ29027
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032412: 71%, ENSRNOG00000011501: 72%
Entrez Gene ID: 483
Uniprot ID: P54709
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL
• Gene Sequence: KPYTLEEQKNLTVCPDGALFEQKGPVYVACQFPISLLQACSGMNDPDFGYSQGNPCIL
• Gene ID - Mouse: ENSMUSG00000032412
• Gene ID - Rat: ENSRNOG00000011501
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.