Anti ATP1A3 pAb (ATL-HPA056446 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA056446-25

• 

Product Description

Protein Description: ATPase, Na+/K+ transporting, alpha 3 polypeptide
Gene Name: ATP1A3
Alternative Gene Name: DYT12
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040907: 100%, ENSRNOG00000020263: 100%
Entrez Gene ID: 478
Uniprot ID: P13637
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
• Gene Sequence: EVAMTEHKMSVEEVCRKYNTDCVQGLTHSKAQE
• Gene ID - Mouse: ENSMUSG00000040907
• Gene ID - Rat: ENSRNOG00000020263
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links