Anti ATP13A2 pAb (ATL-HPA054717)

Atlas Antibodies

SKU:
ATL-HPA054717-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ATPase type 13A2
Gene Name: ATP13A2
Alternative Gene Name: CLN12, HSA9947, PARK9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036622: 69%, ENSRNOG00000008052: 66%
Entrez Gene ID: 23400
Uniprot ID: Q9NQ11
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIET
Gene Sequence EIRDKEDSSWQLFTVQVQTEAIGEGSLEPSPQSQAEDGRSQAAVGAVPEGAWKDTAQLHKSEEAVSVGQKRVLRYYLFQGQRYIWIET
Gene ID - Mouse ENSMUSG00000036622
Gene ID - Rat ENSRNOG00000008052
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATP13A2 pAb (ATL-HPA054717)
Datasheet Anti ATP13A2 pAb (ATL-HPA054717) Datasheet (External Link)
Vendor Page Anti ATP13A2 pAb (ATL-HPA054717) at Atlas Antibodies

Documents & Links for Anti ATP13A2 pAb (ATL-HPA054717)
Datasheet Anti ATP13A2 pAb (ATL-HPA054717) Datasheet (External Link)
Vendor Page Anti ATP13A2 pAb (ATL-HPA054717)