Anti ATOH1 pAb (ATL-HPA049400)

Atlas Antibodies

SKU: ATL-HPA049400-25

• 

Protein Description: atonal bHLH transcription factor 1
Gene Name: ATOH1
Alternative Gene Name: bHLHa14, HATH1, MATH-1, Math1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073043: 90%, ENSRNOG00000006383: 87%
Entrez Gene ID: 474
Uniprot ID: Q92858
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSD
• Gene Sequence: LHFSTFEDSALTAMMAQKNLSPSLPGSILQPVQEENSKTSPRSHRSDGEFSPHSHYSDSD
• Gene ID - Mouse: ENSMUSG00000073043
• Gene ID - Rat: ENSRNOG00000006383
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.