Protein Description: ATM serine/threonine kinase
Gene Name: ATM
Alternative Gene Name: ATA, ATC, ATD, ATDC, TEL1, TELO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034218: 91%, ENSRNOG00000029773: 91%
Entrez Gene ID: 472
Uniprot ID: Q13315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATM
Alternative Gene Name: ATA, ATC, ATD, ATDC, TEL1, TELO1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034218: 91%, ENSRNOG00000029773: 91%
Entrez Gene ID: 472
Uniprot ID: Q13315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE |
| Documents & Links for Anti ATM pAb (ATL-HPA067142) | |
| Datasheet | Anti ATM pAb (ATL-HPA067142) Datasheet (External Link) |
| Vendor Page | Anti ATM pAb (ATL-HPA067142) at Atlas |
| Documents & Links for Anti ATM pAb (ATL-HPA067142) | |
| Datasheet | Anti ATM pAb (ATL-HPA067142) Datasheet (External Link) |
| Vendor Page | Anti ATM pAb (ATL-HPA067142) |