Anti ATL3 pAb (ATL-HPA076616)

Atlas Antibodies

SKU:
ATL-HPA076616-25
  • Immunofluorescent staining of human cell line SiHa shows localization to endoplasmic reticulum.
Shipping:
Calculated at Checkout
$447.00
On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Adding to cart… The item has been added
Protein Description: atlastin GTPase 3
Gene Name: ATL3
Alternative Gene Name: DKFZP564J0863
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024759: 95%, ENSRNOG00000021203: 94%
Entrez Gene ID: 25923
Uniprot ID: Q6DD88
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ
Gene Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ
Gene ID - Mouse ENSMUSG00000024759
Gene ID - Rat ENSRNOG00000021203
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATL3 pAb (ATL-HPA076616)
Datasheet Anti ATL3 pAb (ATL-HPA076616) Datasheet (External Link)
Vendor Page Anti ATL3 pAb (ATL-HPA076616) at Atlas Antibodies

Documents & Links for Anti ATL3 pAb (ATL-HPA076616)
Datasheet Anti ATL3 pAb (ATL-HPA076616) Datasheet (External Link)
Vendor Page Anti ATL3 pAb (ATL-HPA076616)