Protein Description: atlastin GTPase 2
Gene Name: ATL2
Alternative Gene Name: ARL6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059811: 92%, ENSRNOG00000006523: 87%
Entrez Gene ID: 64225
Uniprot ID: Q8NHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ATL2
Alternative Gene Name: ARL6IP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000059811: 92%, ENSRNOG00000006523: 87%
Entrez Gene ID: 64225
Uniprot ID: Q8NHH9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ |
Documents & Links for Anti ATL2 pAb (ATL-HPA075302) | |
Datasheet | Anti ATL2 pAb (ATL-HPA075302) Datasheet (External Link) |
Vendor Page | Anti ATL2 pAb (ATL-HPA075302) at Atlas |
Documents & Links for Anti ATL2 pAb (ATL-HPA075302) | |
Datasheet | Anti ATL2 pAb (ATL-HPA075302) Datasheet (External Link) |
Vendor Page | Anti ATL2 pAb (ATL-HPA075302) |