Anti ATG16L2 pAb (ATL-HPA045444)

Atlas Antibodies

SKU:
ATL-HPA045444-25
  • Immunohistochemical staining of human colon shows strong cytoplasmic positivity in ganglion cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: autophagy related 16-like 2 (S. cerevisiae)
Gene Name: ATG16L2
Alternative Gene Name: ATG16B, FLJ00012, WDR80
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047767: 86%, ENSRNOG00000019413: 82%
Entrez Gene ID: 89849
Uniprot ID: Q8NAA4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNS
Gene Sequence LEKEACEKWKRPFRSASATSLTLSHCVDVVKGLLDFKKRRGHSIGGAPEQRYQIIPVCVAARLPTRAQDVLDAHLSEVNAVRFGPNS
Gene ID - Mouse ENSMUSG00000047767
Gene ID - Rat ENSRNOG00000019413
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ATG16L2 pAb (ATL-HPA045444)
Datasheet Anti ATG16L2 pAb (ATL-HPA045444) Datasheet (External Link)
Vendor Page Anti ATG16L2 pAb (ATL-HPA045444) at Atlas Antibodies

Documents & Links for Anti ATG16L2 pAb (ATL-HPA045444)
Datasheet Anti ATG16L2 pAb (ATL-HPA045444) Datasheet (External Link)
Vendor Page Anti ATG16L2 pAb (ATL-HPA045444)