Anti ATF1 pAb (ATL-HPA055069 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055069-100

• 
• 
• 

Protein Description: activating transcription factor 1
Gene Name: ATF1
Alternative Gene Name: TREB36
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023027: 84%, ENSRNOG00000061088: 86%
Entrez Gene ID: 466
Uniprot ID: P18846
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY
• Gene Sequence: MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSY
• Gene ID - Mouse: ENSMUSG00000023027
• Gene ID - Rat: ENSRNOG00000061088
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ATF1 pAb (ATL-HPA055069 w/enhanced validation) – 1 Found

Endo, Shino; Yoshino, Yuki; Shirota, Matsuyuki; Watanabe, Gou; Chiba, Natsuko. BRCA1/ATF1-Mediated Transactivation is Involved in Resistance to PARP Inhibitors and Cisplatin. Cancer Research Communications. 2021;1(2):90-105.