Protein Description: astrotactin 1
Gene Name: ASTN1
Alternative Gene Name: ASTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026587: 94%, ENSRNOG00000060105: 47%
Entrez Gene ID: 460
Uniprot ID: O14525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASTN1
Alternative Gene Name: ASTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026587: 94%, ENSRNOG00000060105: 47%
Entrez Gene ID: 460
Uniprot ID: O14525
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EDYKLGVDGRSCQLITETCPEGSDCGESRELPMNQTLFGEMFFGYNNHSKEVAAGQVLKGTFRQNNFARGLDQQLPDGLVVATVPLENQCLEEISEPT |
| Documents & Links for Anti ASTN1 pAb (ATL-HPA074112) | |
| Datasheet | Anti ASTN1 pAb (ATL-HPA074112) Datasheet (External Link) |
| Vendor Page | Anti ASTN1 pAb (ATL-HPA074112) at Atlas |
| Documents & Links for Anti ASTN1 pAb (ATL-HPA074112) | |
| Datasheet | Anti ASTN1 pAb (ATL-HPA074112) Datasheet (External Link) |
| Vendor Page | Anti ASTN1 pAb (ATL-HPA074112) |