Anti ASRGL1 pAb (ATL-HPA055572 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA055572-25

• 
• 

Protein Description: asparaginase like 1
Gene Name: ASRGL1
Alternative Gene Name: ALP, ALP1, FLJ22316
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024654: 76%, ENSRNOG00000020202: 74%
Entrez Gene ID: 80150
Uniprot ID: Q7L266
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDT
• Gene Sequence: ARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDT
• Gene ID - Mouse: ENSMUSG00000024654
• Gene ID - Rat: ENSRNOG00000020202
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ASRGL1 pAb (ATL-HPA055572 w/enhanced validation) – 1 Found

Eren Karanis, Meryem İlkay; Küçükosmanoğlu, İlknur; Ünlü, Yaşar; Eryılmaz, Mehmet Ali; Köksal, Hande. Increased expression of ASRGL1 in invasive ductal carcinoma and its association with estrogen-progesterone receptor status of tumors. American Journal Of Translational Research. 13(7):7928-7934.