Anti ASPH pAb (ATL-HPA059303)
Atlas Antibodies
- SKU:
- ATL-HPA059303-25
- Shipping:
- Calculated at Checkout
$303.00
Product Description
Protein Description: aspartate beta-hydroxylase
Gene Name: ASPH
Alternative Gene Name: BAH, CASQ2BP1, HAAH, JCTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028207: 70%, ENSRNOG00000007445: 73%
Entrez Gene ID: 444
Uniprot ID: Q12797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASPH
Alternative Gene Name: BAH, CASQ2BP1, HAAH, JCTN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028207: 70%, ENSRNOG00000007445: 73%
Entrez Gene ID: 444
Uniprot ID: Q12797
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPT |
Gene Sequence | DYEEVLGKLGIYDADGDGDFDVDDAKVLLGLKERSTSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIQSLLHEMVHAEHVEGEDLQQEDGPT |
Gene ID - Mouse | ENSMUSG00000028207 |
Gene ID - Rat | ENSRNOG00000007445 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti ASPH pAb (ATL-HPA059303) | |
Datasheet | Anti ASPH pAb (ATL-HPA059303) Datasheet (External Link) |
Vendor Page | Anti ASPH pAb (ATL-HPA059303) at Atlas Antibodies |
Documents & Links for Anti ASPH pAb (ATL-HPA059303) | |
Datasheet | Anti ASPH pAb (ATL-HPA059303) Datasheet (External Link) |
Vendor Page | Anti ASPH pAb (ATL-HPA059303) |