Anti ASIC4 pAb (ATL-HPA057078)

Atlas Antibodies

SKU: ATL-HPA057078-25

• 

Protein Description: acid sensing ion channel subunit family member 4
Gene Name: ASIC4
Alternative Gene Name: ACCN4, BNAC4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033007: 66%, ENSRNOG00000019985: 66%
Entrez Gene ID: 55515
Uniprot ID: Q96FT7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH
• Gene Sequence: GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH
• Gene ID - Mouse: ENSMUSG00000033007
• Gene ID - Rat: ENSRNOG00000019985
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.