Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA003014-100
  • Immunohistochemistry analysis in human testis and cerebral cortex tissues using HPA003014 antibody. Corresponding ASB9 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell line PC-3 and human cell line HEK 293.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ankyrin repeat and SOCS box containing 9
Gene Name: ASB9
Alternative Gene Name: DKFZP564L0862, FLJ20636, MGC4954
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031384: 72%, ENSRNOG00000003452: 72%
Entrez Gene ID: 140462
Uniprot ID: Q96DX5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV
Gene Sequence GMDGSKPAGPRDFPGIRLLSNPLMGDAVSDWSPMHEAAIHGHQLSLRNLISQGWAVNIITADHVSPLHEACLGGHLSCVKILLKHGAQVNGVTADWHTPLFNACV
Gene ID - Mouse ENSMUSG00000031384
Gene ID - Rat ENSRNOG00000003452
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation)
Datasheet Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation)
Datasheet Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ASB9 pAb (ATL-HPA003014 w/enhanced validation)