Protein Description: ankyrin repeat and SOCS box containing 4
Gene Name: ASB4
Alternative Gene Name: ASB-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042607: 93%, ENSRNOG00000009197: 93%
Entrez Gene ID: 51666
Uniprot ID: Q9Y574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ASB4
Alternative Gene Name: ASB-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042607: 93%, ENSRNOG00000009197: 93%
Entrez Gene ID: 51666
Uniprot ID: Q9Y574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | VWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEH |
| Gene ID - Mouse | ENSMUSG00000042607 |
| Gene ID - Rat | ENSMUSG00000042607 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ASB4 pAb (ATL-HPA055240) | |
| Datasheet | Anti ASB4 pAb (ATL-HPA055240) Datasheet (External Link) |
| Vendor Page | Anti ASB4 pAb (ATL-HPA055240) at Atlas |
| Documents & Links for Anti ASB4 pAb (ATL-HPA055240) | |
| Datasheet | Anti ASB4 pAb (ATL-HPA055240) Datasheet (External Link) |
| Vendor Page | Anti ASB4 pAb (ATL-HPA055240) |