Anti ASB4 pAb (ATL-HPA055240)
Atlas Antibodies
- Catalog No.:
- ATL-HPA055240-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ASB4
Alternative Gene Name: ASB-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042607: 93%, ENSRNOG00000009197: 93%
Entrez Gene ID: 51666
Uniprot ID: Q9Y574
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEH |
Gene Sequence | VWRGANVNMKTNNQDEETPLHTAAHFGLSELVAFYVEHGAIVDSVNAHMETPLAIAAYWALRFKEQEYSTEH |
Gene ID - Mouse | ENSMUSG00000042607 |
Gene ID - Rat | ENSRNOG00000009197 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ASB4 pAb (ATL-HPA055240) | |
Datasheet | Anti ASB4 pAb (ATL-HPA055240) Datasheet (External Link) |
Vendor Page | Anti ASB4 pAb (ATL-HPA055240) at Atlas Antibodies |
Documents & Links for Anti ASB4 pAb (ATL-HPA055240) | |
Datasheet | Anti ASB4 pAb (ATL-HPA055240) Datasheet (External Link) |
Vendor Page | Anti ASB4 pAb (ATL-HPA055240) |