Anti ASB13 pAb (ATL-HPA061742)

Atlas Antibodies

SKU: ATL-HPA061742-25

• 

Protein Description: ankyrin repeat and SOCS box containing 13
Gene Name: ASB13
Alternative Gene Name: FLJ13134, MGC19879
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033781: 96%, ENSRNOG00000017967: 96%
Entrez Gene ID: 79754
Uniprot ID: Q8WXK3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI
• Gene Sequence: KVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNI
• Gene ID - Mouse: ENSMUSG00000033781
• Gene ID - Rat: ENSRNOG00000017967
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.