Anti ASAP1 pAb (ATL-HPA048565)

Atlas Antibodies

SKU: ATL-HPA048565-25

• 
• 

Protein Description: ArfGAP with SH3 domain, ankyrin repeat and PH domain 1
Gene Name: ASAP1
Alternative Gene Name: CENTB4, DDEF1, KIAA1249, PAP, ZG14P
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022377: 93%, ENSRNOG00000058733: 92%
Entrez Gene ID: 50807
Uniprot ID: Q9ULH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
• Gene Sequence: PKPGELPPKPQLGDLPPKPQLSDLPPKPQMKDLPPKPQLGDLLAKSQTGDVSPKAQQPSEVTLKSHPLDLSPNVQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDC
• Gene ID - Mouse: ENSMUSG00000022377
• Gene ID - Rat: ENSRNOG00000058733
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.