Anti ARVCF pAb (ATL-HPA055264)

Atlas Antibodies

SKU: ATL-HPA055264-25

• 

Protein Description: armadillo repeat gene deleted in velocardiofacial syndrome
Gene Name: ARVCF
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000098615: 96%, ENSRNOG00000001888: 96%
Entrez Gene ID: 421
Uniprot ID: O00192
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDPGTPTSHVSIV
• Gene Sequence: HVALQLERAQQPGMVSGGMGSGQPLPMAWQQLVLQEQSPGSQASLATMPEAPDVLEETVTVEEDPGTPTSHVSIV
• Gene ID - Mouse: ENSMUSG00000098615
• Gene ID - Rat: ENSRNOG00000001888
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.