Anti ARRDC2 pAb (ATL-HPA053788)

Atlas Antibodies

SKU: ATL-HPA053788-25

• 
• 

Protein Description: arrestin domain containing 2
Gene Name: ARRDC2
Alternative Gene Name: CLONE24945, PP2703
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000110906: 85%, ENSRNOG00000045649: 49%
Entrez Gene ID: 27106
Uniprot ID: Q8TBH0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVIPVFAEIDNGSTRPVLPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDYALKVCVD
• Gene Sequence: EVIPVFAEIDNGSTRPVLPRAAVVQTQTFMARGARKQKRAVVASLAGEPVGPGQRALWQGRALRIPPVGPSILHCRVLHVDYALKVCVD
• Gene ID - Mouse: ENSMUSG00000110906
• Gene ID - Rat: ENSRNOG00000045649
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.