Anti ARRB2 pAb (ATL-HPA065681)
Atlas Antibodies
- SKU:
- ATL-HPA065681-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ARRB2
Alternative Gene Name: ARR2, BARR2, DKFZp686L0365
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000060216: 94%, ENSRNOG00000019308: 94%
Entrez Gene ID: 409
Uniprot ID: P32121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | DLFIATYQAFPPVPNPPRPPTRLQDRLLRKL |
Gene Sequence | DLFIATYQAFPPVPNPPRPPTRLQDRLLRKL |
Gene ID - Mouse | ENSMUSG00000060216 |
Gene ID - Rat | ENSRNOG00000019308 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ARRB2 pAb (ATL-HPA065681) | |
Datasheet | Anti ARRB2 pAb (ATL-HPA065681) Datasheet (External Link) |
Vendor Page | Anti ARRB2 pAb (ATL-HPA065681) at Atlas Antibodies |
Documents & Links for Anti ARRB2 pAb (ATL-HPA065681) | |
Datasheet | Anti ARRB2 pAb (ATL-HPA065681) Datasheet (External Link) |
Vendor Page | Anti ARRB2 pAb (ATL-HPA065681) |