Anti ARPC2 pAb (ATL-HPA052703)

Atlas Antibodies

SKU: ATL-HPA052703-25

• 

Protein Description: actin related protein 2/3 complex subunit 2
Gene Name: ARPC2
Alternative Gene Name: ARC34, p34-Arc
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006304: 99%, ENSRNOG00000014289: 100%
Entrez Gene ID: 10109
Uniprot ID: O15144
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY
• Gene Sequence: FDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHY
• Gene ID - Mouse: ENSMUSG00000006304
• Gene ID - Rat: ENSRNOG00000014289
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.