Anti ARNTL pAb (ATL-HPA050938)

Atlas Antibodies

SKU: ATL-HPA050938-25

• 

Protein Description: aryl hydrocarbon receptor nuclear translocator-like
Gene Name: ARNTL
Alternative Gene Name: bHLHe5, BMAL1, JAP3, MOP3, PASD3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055116: 96%, ENSRNOG00000014448: 96%
Entrez Gene ID: 406
Uniprot ID: O00327
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
• Gene Sequence: SSPLNITSTPPPDASSPGGKKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
• Gene ID - Mouse: ENSMUSG00000055116
• Gene ID - Rat: ENSRNOG00000014448
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.