Anti ARMCX6 pAb (ATL-HPA048125)

Atlas Antibodies

SKU: ATL-HPA048125-25

• 
• 

Protein Description: armadillo repeat containing, X-linked 6
Gene Name: ARMCX6
Alternative Gene Name: FLJ20811, GASP10
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050394: 65%, ENSRNOG00000037707: 66%
Entrez Gene ID: 54470
Uniprot ID: Q7L4S7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQMLFSFMSLFIRNGNREILLETPAP
• Gene Sequence: LKFPLISEGSGCAKVQVLKPLMGLSEKPVLAGELVGAQMLFSFMSLFIRNGNREILLETPAP
• Gene ID - Mouse: ENSMUSG00000050394
• Gene ID - Rat: ENSRNOG00000037707
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.