Anti ARMCX4 pAb (ATL-HPA051930)

Atlas Antibodies

SKU: ATL-HPA051930-25

• 

Protein Description: armadillo repeat containing, X-linked 4
Gene Name: ARMCX4
Alternative Gene Name: CXorf35, GASP4, MGC40053
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049804: 64%, ENSRNOG00000043128: 63%
Entrez Gene ID: 100131755
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TKFAHQSEASFPVEDESRKQTRTGEKTRPWSCRCKHEANMDPRDLEKLICMIEMTEDPSVHEIANNALYNSADYSYSHEVVRNVGGI
• Gene Sequence: TKFAHQSEASFPVEDESRKQTRTGEKTRPWSCRCKHEANMDPRDLEKLICMIEMTEDPSVHEIANNALYNSADYSYSHEVVRNVGGI
• Gene ID - Mouse: ENSMUSG00000049804
• Gene ID - Rat: ENSRNOG00000043128
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.