Anti ARL6IP1 pAb (ATL-HPA045307)

Atlas Antibodies

SKU:
ATL-HPA045307-25
  • Immunohistochemical staining of human testis shows weak to moderate cytoplasmic positivity in cells in seminiferous ducts.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 6 interacting protein 1
Gene Name: ARL6IP1
Alternative Gene Name: AIP1, ARL6IP, ARMER, KIAA0069, SPG61
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030654: 98%, ENSRNOG00000017751: 100%
Entrez Gene ID: 23204
Uniprot ID: Q15041
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
Gene Sequence FGSNKWTTEQQQRFHEICSNLVKTRRRAVGWWKRLFTLKEE
Gene ID - Mouse ENSMUSG00000030654
Gene ID - Rat ENSRNOG00000017751
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARL6IP1 pAb (ATL-HPA045307)
Datasheet Anti ARL6IP1 pAb (ATL-HPA045307) Datasheet (External Link)
Vendor Page Anti ARL6IP1 pAb (ATL-HPA045307) at Atlas Antibodies

Documents & Links for Anti ARL6IP1 pAb (ATL-HPA045307)
Datasheet Anti ARL6IP1 pAb (ATL-HPA045307) Datasheet (External Link)
Vendor Page Anti ARL6IP1 pAb (ATL-HPA045307)