Anti ARL2BP pAb (ATL-HPA048440)

Atlas Antibodies

SKU: ATL-HPA048440-25

• 

Protein Description: ADP-ribosylation factor-like 2 binding protein
Gene Name: ARL2BP
Alternative Gene Name: BART, BART1, RP66
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031776: 97%, ENSRNOG00000016991: 97%
Entrez Gene ID: 23568
Uniprot ID: Q9Y2Y0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNN
• Gene Sequence: IPEFNMAAFTTTLQHHKDEVAGDIFDMLLTFTDFLAFKEMFLDYRAEKEGRGLDLSSGLVVTSLCKSSSLPASQNN
• Gene ID - Mouse: ENSMUSG00000031776
• Gene ID - Rat: ENSRNOG00000016991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.