Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA047044-100
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ARL10 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY406546).
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: ADP-ribosylation factor-like 10
Gene Name: ARL10
Alternative Gene Name: ARL10A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025870: 88%, ENSRNOG00000045948: 89%
Entrez Gene ID: 285598
Uniprot ID: Q8N8L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVV
Gene Sequence AGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVV
Gene ID - Mouse ENSMUSG00000025870
Gene ID - Rat ENSRNOG00000045948
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation)
Datasheet Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation)
Datasheet Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation)