Anti ARL10 pAb (ATL-HPA047044 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047044-100

• 
• 

Protein Description: ADP-ribosylation factor-like 10
Gene Name: ARL10
Alternative Gene Name: ARL10A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025870: 88%, ENSRNOG00000045948: 89%
Entrez Gene ID: 285598
Uniprot ID: Q8N8L6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVV
• Gene Sequence: AGKSTFLRVLSGKPPLEGHIPTWGFNSVRLPTKDFEVDLLEIGGSQNLRFYWKEFVSEVDVLVFVVDSADRLRLPWARQELHKLLDKDPDLPVV
• Gene ID - Mouse: ENSMUSG00000025870
• Gene ID - Rat: ENSRNOG00000045948
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.