Protein Description: ariadne RBR E3 ubiquitin protein ligase 2
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064145: 98%, ENSRNOG00000031827: 96%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARIH2
Alternative Gene Name: TRIAD1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000064145: 98%, ENSRNOG00000031827: 96%
Entrez Gene ID: 10425
Uniprot ID: O95376
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RVQPNPSKHVPTSHPPHHCAVCMQFVRKENLLSLACQHQFCRSCWEQHCSVLVKDGVGVGVSCMAQDCPLRTPEDFVFPLL |
| Documents & Links for Anti ARIH2 pAb (ATL-HPA070963) | |
| Datasheet | Anti ARIH2 pAb (ATL-HPA070963) Datasheet (External Link) |
| Vendor Page | Anti ARIH2 pAb (ATL-HPA070963) at Atlas |
| Documents & Links for Anti ARIH2 pAb (ATL-HPA070963) | |
| Datasheet | Anti ARIH2 pAb (ATL-HPA070963) Datasheet (External Link) |
| Vendor Page | Anti ARIH2 pAb (ATL-HPA070963) |