Anti ARHGEF37 pAb (ATL-HPA053487)

Atlas Antibodies

SKU:
ATL-HPA053487-25
  • Immunohistochemical staining of human skin shows cytoplasmic positivity in epidermis.
  • Immunofluorescent staining of human cell line HaCaT shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 37
Gene Name: ARHGEF37
Alternative Gene Name: FLJ41603
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045094: 78%, ENSRNOG00000025502: 76%
Entrez Gene ID: 389337
Uniprot ID: A1IGU5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TYQALNSLLVAELPQFNQLVMQWLGQILCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEKVQPPP
Gene Sequence TYQALNSLLVAELPQFNQLVMQWLGQILCTFVTLQRDLAKQVLQRAEGSMAQLPHHHVPEPAFRKLVEDALGRTSNQLRSFQETFEKVQPPP
Gene ID - Mouse ENSMUSG00000045094
Gene ID - Rat ENSRNOG00000025502
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGEF37 pAb (ATL-HPA053487)
Datasheet Anti ARHGEF37 pAb (ATL-HPA053487) Datasheet (External Link)
Vendor Page Anti ARHGEF37 pAb (ATL-HPA053487) at Atlas Antibodies

Documents & Links for Anti ARHGEF37 pAb (ATL-HPA053487)
Datasheet Anti ARHGEF37 pAb (ATL-HPA053487) Datasheet (External Link)
Vendor Page Anti ARHGEF37 pAb (ATL-HPA053487)



Citations for Anti ARHGEF37 pAb (ATL-HPA053487) – 1 Found
Zhang, Xin; Ren, Liangliang; Wu, Junhua; Feng, Rongni; Chen, Yunyang; Li, Ronggang; Wu, Meimei; Zheng, Mingzhu; Wu, Xing Gui; Luo, Wanjun; He, Hongle; Huang, Yanming; Tang, Miaoling; Li, Jun. ARHGEF37 overexpression promotes extravasation and metastasis of hepatocellular carcinoma via directly activating Cdc42. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):230.  PubMed