Anti ARHGEF35 pAb (ATL-HPA045699)

Atlas Antibodies

Catalog No.:
ATL-HPA045699-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 35
Gene Name: ARHGEF35
Alternative Gene Name: ARHGEF5L, CTAGE4, FLJ43692
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033542: 48%, ENSRNOG00000005506: 55%
Entrez Gene ID: 445328
Uniprot ID: A5YM69
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGLNDGEWE
Gene Sequence HPQEVQVLEEQGQQEAGFRGEGTLREDVCADGLLGEEQMIEQVNDEKGEQKQKQEQVQDVMLGRQGERMGLTGEPEGLNDGEWE
Gene ID - Mouse ENSMUSG00000033542
Gene ID - Rat ENSRNOG00000005506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ARHGEF35 pAb (ATL-HPA045699)
Datasheet Anti ARHGEF35 pAb (ATL-HPA045699) Datasheet (External Link)
Vendor Page Anti ARHGEF35 pAb (ATL-HPA045699) at Atlas Antibodies

Documents & Links for Anti ARHGEF35 pAb (ATL-HPA045699)
Datasheet Anti ARHGEF35 pAb (ATL-HPA045699) Datasheet (External Link)
Vendor Page Anti ARHGEF35 pAb (ATL-HPA045699)