Anti ARHGEF3 pAb (ATL-HPA064945)

Atlas Antibodies

SKU:
ATL-HPA064945-25
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 3
Gene Name: ARHGEF3
Alternative Gene Name: DKFZP434F2429, GEF3, STA3, XPLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021895: 92%, ENSRNOG00000014363: 89%
Entrez Gene ID: 50650
Uniprot ID: Q9NR81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK
Gene Sequence LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK
Gene ID - Mouse ENSMUSG00000021895
Gene ID - Rat ENSRNOG00000014363
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGEF3 pAb (ATL-HPA064945)
Datasheet Anti ARHGEF3 pAb (ATL-HPA064945) Datasheet (External Link)
Vendor Page Anti ARHGEF3 pAb (ATL-HPA064945) at Atlas Antibodies

Documents & Links for Anti ARHGEF3 pAb (ATL-HPA064945)
Datasheet Anti ARHGEF3 pAb (ATL-HPA064945) Datasheet (External Link)
Vendor Page Anti ARHGEF3 pAb (ATL-HPA064945)