Protein Description: Rho guanine nucleotide exchange factor (GEF) 3
Gene Name: ARHGEF3
Alternative Gene Name: DKFZP434F2429, GEF3, STA3, XPLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021895: 92%, ENSRNOG00000014363: 89%
Entrez Gene ID: 50650
Uniprot ID: Q9NR81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGEF3
Alternative Gene Name: DKFZP434F2429, GEF3, STA3, XPLN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021895: 92%, ENSRNOG00000014363: 89%
Entrez Gene ID: 50650
Uniprot ID: Q9NR81
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIK |
Documents & Links for Anti ARHGEF3 pAb (ATL-HPA064945) | |
Datasheet | Anti ARHGEF3 pAb (ATL-HPA064945) Datasheet (External Link) |
Vendor Page | Anti ARHGEF3 pAb (ATL-HPA064945) at Atlas |
Documents & Links for Anti ARHGEF3 pAb (ATL-HPA064945) | |
Datasheet | Anti ARHGEF3 pAb (ATL-HPA064945) Datasheet (External Link) |
Vendor Page | Anti ARHGEF3 pAb (ATL-HPA064945) |