Anti ARHGEF25 pAb (ATL-HPA052016 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA052016-25
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Western blot analysis in control (vector only transfected HEK293T lysate) and ARHGEF25 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY405275).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho guanine nucleotide exchange factor (GEF) 25
Gene Name: ARHGEF25
Alternative Gene Name: GEFT, p63RhoGEF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019467: 83%, ENSRNOG00000005034: 83%
Entrez Gene ID: 115557
Uniprot ID: Q86VW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYV
Gene Sequence HSKHCLSVETEADSGQAGPYENWMLEPALATGEELPELTLLTTLLEGPGDKTQPPEEETLSQAPESEEEQKKKALERSMYV
Gene ID - Mouse ENSMUSG00000019467
Gene ID - Rat ENSRNOG00000005034
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ARHGEF25 pAb (ATL-HPA052016 w/enhanced validation)
Datasheet Anti ARHGEF25 pAb (ATL-HPA052016 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGEF25 pAb (ATL-HPA052016 w/enhanced validation)