Protein Description: Rho GTPase activating protein 9
Gene Name: ARHGAP9
Alternative Gene Name: 10C, MGC1295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040345: 59%, ENSRNOG00000006946: 43%
Entrez Gene ID: 64333
Uniprot ID: Q9BRR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGAP9
Alternative Gene Name: 10C, MGC1295
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040345: 59%, ENSRNOG00000006946: 43%
Entrez Gene ID: 64333
Uniprot ID: Q9BRR9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | NPGSMEGTQTLKRNNDVLQPQAKGFRSDTGTPEPLDPQGSLSLSQRTSQLDPPALQAPRPLPQLLDDPHEVEKSGLLNMTKIAQGGRKLRKNW |
Documents & Links for Anti ARHGAP9 pAb (ATL-HPA078822) | |
Datasheet | Anti ARHGAP9 pAb (ATL-HPA078822) Datasheet (External Link) |
Vendor Page | Anti ARHGAP9 pAb (ATL-HPA078822) at Atlas |
Documents & Links for Anti ARHGAP9 pAb (ATL-HPA078822) | |
Datasheet | Anti ARHGAP9 pAb (ATL-HPA078822) Datasheet (External Link) |
Vendor Page | Anti ARHGAP9 pAb (ATL-HPA078822) |