Anti ARHGAP32 pAb (ATL-HPA061505)

Atlas Antibodies

SKU:
ATL-HPA061505-25
  • Immunohistochemical staining of human liver shows moderate cytoplasmic positivity in hepatocytes and strong cytoplasmic and nuclear positivity in bile duct cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 32
Gene Name: ARHGAP32
Alternative Gene Name: GC-GAP, GRIT, KIAA0712, MGC1892, RICS
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041444: 93%, ENSRNOG00000008709: 94%
Entrez Gene ID: 9743
Uniprot ID: A7KAX9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PNDHNVVSMPPAADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGK
Gene Sequence PNDHNVVSMPPAADVKHTYTSWDLEDMEKYRMQSIRRESRARQKVKGPVMSQYDNMTPAVQDDLGGIYVIHLRSKSDPGKTGLLSVAEGK
Gene ID - Mouse ENSMUSG00000041444
Gene ID - Rat ENSRNOG00000008709
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP32 pAb (ATL-HPA061505)
Datasheet Anti ARHGAP32 pAb (ATL-HPA061505) Datasheet (External Link)
Vendor Page Anti ARHGAP32 pAb (ATL-HPA061505) at Atlas Antibodies

Documents & Links for Anti ARHGAP32 pAb (ATL-HPA061505)
Datasheet Anti ARHGAP32 pAb (ATL-HPA061505) Datasheet (External Link)
Vendor Page Anti ARHGAP32 pAb (ATL-HPA061505)