Anti ARHGAP25 pAb (ATL-HPA061395 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA061395-25
  • Immunohistochemistry analysis in human spleen and cerebral cortex tissues using Anti-ARHGAP25 antibody. Corresponding ARHGAP25 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
  • Western blot analysis using Anti-ARHGAP25 antibody HPA061395 (A) shows similar pattern to independent antibody HPA035346 (B).
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 25
Gene Name: ARHGAP25
Alternative Gene Name: KIAA0053
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030047: 90%, ENSRNOG00000009347: 90%
Entrez Gene ID: 9938
Uniprot ID: P42331
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPC
Gene Sequence LYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEMEEWVKFLRRVAGTPC
Gene ID - Mouse ENSMUSG00000030047
Gene ID - Rat ENSRNOG00000009347
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ARHGAP25 pAb (ATL-HPA061395 w/enhanced validation)
Datasheet Anti ARHGAP25 pAb (ATL-HPA061395 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ARHGAP25 pAb (ATL-HPA061395 w/enhanced validation)