Protein Description: Rho GTPase activating protein 11A
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 64%, ENSRNOG00000008115: 67%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 64%, ENSRNOG00000008115: 67%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKVPLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKPV |
| Documents & Links for Anti ARHGAP11A pAb (ATL-HPA066481) | |
| Datasheet | Anti ARHGAP11A pAb (ATL-HPA066481) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP11A pAb (ATL-HPA066481) at Atlas |
| Documents & Links for Anti ARHGAP11A pAb (ATL-HPA066481) | |
| Datasheet | Anti ARHGAP11A pAb (ATL-HPA066481) Datasheet (External Link) |
| Vendor Page | Anti ARHGAP11A pAb (ATL-HPA066481) |