Anti ARHGAP11A pAb (ATL-HPA066481)

Atlas Antibodies

SKU:
ATL-HPA066481-25
  • Immunohistochemical staining of human lymph node shows nuclear and cytoplasmic positivity in germinal center cells and non-germinal center cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: Rho GTPase activating protein 11A
Gene Name: ARHGAP11A
Alternative Gene Name: KIAA0013
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000041219: 64%, ENSRNOG00000008115: 67%
Entrez Gene ID: 9824
Uniprot ID: Q6P4F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKVPLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKPV
Gene Sequence ELPSKSFLKMRKHPDSVNASLRSTTVYKQKILSDGQVKVPLDDLTNHDIVKPVVNNNMGISSGINNRVLRRPSERGRAWYKGSPKHPIGKTQLLPTSKPV
Gene ID - Mouse ENSMUSG00000041219
Gene ID - Rat ENSRNOG00000008115
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ARHGAP11A pAb (ATL-HPA066481)
Datasheet Anti ARHGAP11A pAb (ATL-HPA066481) Datasheet (External Link)
Vendor Page Anti ARHGAP11A pAb (ATL-HPA066481) at Atlas Antibodies

Documents & Links for Anti ARHGAP11A pAb (ATL-HPA066481)
Datasheet Anti ARHGAP11A pAb (ATL-HPA066481) Datasheet (External Link)
Vendor Page Anti ARHGAP11A pAb (ATL-HPA066481)