Anti ARGLU1 pAb (ATL-HPA056792)

Atlas Antibodies

SKU: ATL-HPA056792-25

• 
• 

Product Description

Protein Description: arginine and glutamate rich 1
Gene Name: ARGLU1
Alternative Gene Name: FLJ10154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040459: 91%, ENSRNOG00000024142: 91%
Entrez Gene ID: 55082
Uniprot ID: Q9NWB6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR
• Gene Sequence: RSRSTNTAVSRRERDRERASSPPDRIDIFGRTVSKRSSLDEKQKR
• Gene ID - Mouse: ENSMUSG00000040459
• Gene ID - Rat: ENSRNOG00000024142
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links